SARS-CoV-2 Nucleocapsid (N) Protein, Ecoli (50 µg)

SARS-CoV-2 Nucleocapsid (N) Protein, Ecoli (50 µg)

Cat. #: VPN2
Availability: In Stock
$199.00
-+
Protein Name:  
SARS-CoV-2 Nucleocapsid Recombinant Protein
Description: Coronaviruses are enveloped viruses with a positive-sense RNA genome and with a nucleocapsid of helical symmetry. Coronavirus nucleoproteins localize to the cytoplasm and the nucleolus, a subnuclear structure, in both virus-infected primary cells and in cells transfected with plasmids that express N protein. Coronavirus N protein is required for coronavirus RNA synthesis, and has RNA chaperone activity that may be involved in template switch. Nucleocapsid protein is a most abundant protein of coronavirus. During virion assembly, N protein binds to viral RNA and leads to formation of the helical nucleocapsid. Nucleocapsid protein is a highly immunogenic phosphoprotein also implicated in viral genome replication and in modulating cell signaling pathways. Because of the conservation of N protein sequence and its strong immunogenicity, the N protein of coronavirus is chosen as a diagnostic tool.
UniProt Accession ID: P59595
Amino Acid Sequence: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPIN
TNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPAN
NAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLES
KMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFA
PSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKK
QQTVTLLPAADLDDFSKQLQQSMSSADSTQAHHHHHH
Expression Host: Escherichia Coli
Purity:
>95% as established by reducing sodium dodecyl sulfate-polyacrylamide gel electrophoresis
Tag:
Six histidine (His) residues at the N-terminus of the protein
Molecular Weight:
49 kDa
Validated Applications:
Western blotting; ELISA; Immunoprecipitation
Storage Buffer:: 0.02 M Tris buffer, pH 8.0
Storage: Store at -20°C
Documents:   Request a manual/MSDS

Related Products


LifeSct © 2022

Publications

text_heading

Our Location

9610 Medical Center Drive, Suite 240, Rockville, MD 20850

1-240-715-2985

1-240-252-7376