Your shopping cart is empty!
Protein Name: | SARS-CoV-2 Nucleocapsid Recombinant Protein |
Description: | Coronaviruses are enveloped viruses with a positive-sense RNA genome and with a nucleocapsid of helical symmetry. Coronavirus nucleoproteins localize to the cytoplasm and the nucleolus, a subnuclear structure, in both virus-infected primary cells and in cells transfected with plasmids that express N protein. Coronavirus N protein is required for coronavirus RNA synthesis, and has RNA chaperone activity that may be involved in template switch. Nucleocapsid protein is a most abundant protein of coronavirus. During virion assembly, N protein binds to viral RNA and leads to formation of the helical nucleocapsid. Nucleocapsid protein is a highly immunogenic phosphoprotein also implicated in viral genome replication and in modulating cell signaling pathways. Because of the conservation of N protein sequence and its strong immunogenicity, the N protein of coronavirus is chosen as a diagnostic tool. |
UniProt Accession ID: | P59595 |
Amino Acid Sequence: | MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPIN TNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPAN NAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLES KMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFA PSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKK QQTVTLLPAADLDDFSKQLQQSMSSADSTQAHHHHHH |
Expression Host: | Insect Cells |
Purity: | >95% as established by reducing sodium dodecyl sulfate-polyacrylamide gel electrophoresis |
Tag: | Six histidine (His) residues at the C-terminus of the protein |
Molecular Weight: | 49 kDa |
Validated Applications: | ELISA |
Storage Buffer:: | 0.02 M Tris buffer, pH 8.0 |
Storage: | Store at -20°C |
Documents: | Please contact us to request the manual |